PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_06609_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 345aa    MW: 37686.9 Da    PI: 9.1455
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_06609_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.71.2e-4173149177
                                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                 +CqvegCe+dls++k y+ rhkvC +hsk+p+++v+g+eqrfCqqCsrfh+l efD+ krsCrrrLa+hnerrrk++
  Cotton_A_06609_BGI-A2_v1.0  73 RCQVEGCEVDLSDVKAYYARHKVCVTHSKSPKAIVAGIEQRFCQQCSRFHQLPEFDKVKRSCRRRLAGHNERRRKPS 149
                                 6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.2E-3368135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.55671148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-3972152IPR004333Transcription factor, SBP-box
PfamPF031102.2E-3174147IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGSSSLSDSG GSSIDSLNNN ALKLGRNIYF NDSSAAVNDG PATMKTQSPP SQRPLGCKKP  60
RAGGMIHGGQ PPRCQVEGCE VDLSDVKAYY ARHKVCVTHS KSPKAIVAGI EQRFCQQCSR  120
FHQLPEFDKV KRSCRRRLAG HNERRRKPSP GSLFPPHFGR LSSSVIESNG RGRSFILDFT  180
AYSRVSGKDA CPTMRSLDRI PGNQNTAPGK SLQHHHPWPN NSENPSSGDI FLQGSLGGTG  240
FSSTTTSQGE WFTGVSDSSC ALSLLSNQPW GSKNRASALG VNDMMNTEPM PHGTFVNPYL  300
QTSEPADAQH FGRLELPQQN SVQHMELEQH SRSFDTSAQY VHWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-29741471184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223230.0KJ622323.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL15) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434994.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotA3C0577e-59SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLA0A088DLF80.0A0A088DLF8_G
STRINGVIT_08s0007g06270.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.11e-48squamosa promoter binding protein-like 15